PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10006284m
Common NameCARUB_v10006284mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 161aa    MW: 18483.1 Da    PI: 10.2509
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10006284mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.91.6e-153075147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg WT+  d++l+++v+ +G ++W++I ++m+  Rt+k+c+ rw++ 
  Carubv10006284m 30 RGHWTQSQDLKLIELVEAYGLDNWDLIGEKMQ-ARTGKSCRFRWLNQ 75
                     899*****************************.***********996 PP

2Myb_DNA-binding52.21.4e-1684127348
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      ++T eE+++ v a++ +G++ W++Ia+++  gRt+ ++k++w+ ++
  Carubv10006284m  84 PFTVEEEKIMVSAHNFYGNK-WSKIAKHLK-GRTDIDVKNHWNVHM 127
                      89******************.********9.************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.5E-122978IPR001005SANT/Myb domain
PROSITE profilePS5129412.2923076IPR017930Myb domain
PfamPF002495.9E-153075IPR001005SANT/Myb domain
SuperFamilySSF466893.79E-2830123IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.9E-223183IPR009057Homeodomain-like
CDDcd001671.50E-113374No hitNo description
PROSITE profilePS5129423.99177131IPR017930Myb domain
SMARTSM007171.1E-1381129IPR001005SANT/Myb domain
PfamPF002491.4E-1383126IPR001005SANT/Myb domain
CDDcd001672.27E-1084127No hitNo description
Gene3DG3DSA:1.10.10.603.7E-2184130IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
RPVNGVGANN ALSLRETQQE ERKSPYLGGR GHWTQSQDLK LIELVEAYGL DNWDLIGEKM  60
QARTGKSCRF RWLNQLDPTI NKAPFTVEEE KIMVSAHNFY GNKWSKIAKH LKGRTDIDVK  120
NHWNVHMNRT AWRSQTKTKK RCFTAALNPY GYHVPGMCLL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-30301297106B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1108113KHLKGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006284977.11e-119hypothetical protein CARUB_v10006284mg, partial
TrEMBLR0GZW91e-119R0GZW9_9BRAS; Uncharacterized protein (Fragment)
STRINGAT5G39700.15e-50(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17330310
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39700.11e-53myb domain protein 89